PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000807341
Common NameMYB1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 413aa    MW: 45251.9 Da    PI: 6.9753
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000807341genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.4e-173378147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+W++eEd  l ++v  +G ++W++Iar ++ gR++k+c++rw + 
    MDP0000807341 33 RGPWSPEEDAVLSRLVSNFGARNWSLIARGIP-GRSGKSCRLRWCNQ 78
                     89******************************.***********985 PP

2Myb_DNA-binding52.89.4e-1785129147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++++eEd ++v a++ +G++ W+ Ia+ ++ gRt++ +k++w++ 
    MDP0000807341  85 RKPFSEEEDRIIVSAHAIHGNK-WAVIAKLLP-GRTDNGIKNHWNST 129
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.8022879IPR017930Myb domain
SuperFamilySSF466893.09E-3030126IPR009057Homeodomain-like
SMARTSM007175.6E-143281IPR001005SANT/Myb domain
PfamPF002494.6E-163378IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.6E-263486IPR009057Homeodomain-like
CDDcd001671.89E-133577No hitNo description
PROSITE profilePS5129425.06280134IPR017930Myb domain
SMARTSM007171.4E-1584132IPR001005SANT/Myb domain
PfamPF002498.5E-1585129IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-2387133IPR009057Homeodomain-like
CDDcd001676.13E-1287130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MTAPNGAVPK QADDRPGTEA ELNEGAVPNG KVRGPWSPEE DAVLSRLVSN FGARNWSLIA  60
RGIPGRSGKS CRLRWCNQLD PCVKRKPFSE EEDRIIVSAH AIHGNKWAVI AKLLPGRTDN  120
GIKNHWNSTL RRKCFDKGRF NTGPGEMMED DTFDRKNASS EETLSVGNIS SFKTHEGREV  180
LMENRPNQFD VRSHAKEGSG AAESKHNSTL IAEPRDHPTL QSTICCPVAR VSAFSVYNRP  240
SVPANASSLS RTVPSHGPLV PITKLDFGFD NFLEGACNEP TVPQRCGHGC CDRIEGHSQS  300
SLLGPEFVEY DEPLPFSSHE LISIATDLNK IAWIKGGLES NGIRMPEHVA SQRVFQAAAT  360
TLQMGLPANT PMNDHMRFEE GRNKLMGMMT DVLSTQVPRQ TFAMPTEVEG LS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-39321336107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.163150.0bud| leaf
Function -- GeneRIF ? help Back to Top
  1. Data indicate that the red skin color phenotype was usually associated with the MdMYB1-1 allele and A(1) allele, respectively.
    [PMID: 25366802]
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0164900.0EF016490.1 Malus x domestica cultivar Royal Gala Myb transcription factor (MYB1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288045.10.0transcription factor MYB86-like
TrEMBLA0FK200.0A0FK20_MALDO; MYB domain class transcription factor
STRINGVIT_13s0019g03200.t011e-138(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39863362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.11e-100myb domain protein 109
Publications ? help Back to Top
  1. Zhang XJ, et al.
    A and MdMYB1 allele-specific markers controlling apple (Malus x domestica Borkh.) skin color and suitability for marker-assisted selection.
    Genet. Mol. Res., 2014. 13(4): p. 9103-14
    [PMID:25366802]